PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.4G155800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 286aa    MW: 30446.8 Da    PI: 5.259
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.4G155800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1551.8e-17121174356
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                         e kr rr+ +NRe+ArrsR+RK+a++ eLe  v++L++eN +L k+l+e +++ 
  Sevir.4G155800.1.p 121 ETKRIRRMVSNRESARRSRRRKQAQLSELESQVEQLKGENATLFKQLSEANQQF 174
                         679*****************************************9888877765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.5E-18119183IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.679121173IPR004827Basic-leucine zipper domain
PfamPF001704.5E-15121173IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.29E-12123175No hitNo description
Gene3DG3DSA:1.20.5.1702.7E-14123174No hitNo description
CDDcd147021.36E-6124174No hitNo description
PROSITE patternPS000360126141IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MKKCPSELQL EAFIRESGEG AVSGAAESKP SGSGPSEPGG SGVFSPGDIG FGDTSAMDGN  60
SWWFGSIRPA NPVASQTASI SASPRATTSA NHALESESDS DSESLYEVEG GSCERGTKSM  120
ETKRIRRMVS NRESARRSRR RKQAQLSELE SQVEQLKGEN ATLFKQLSEA NQQFTTAVTD  180
NRILKSDVEA LRVKVKMAED MVARSAMSCG LGDLGLAPYL NSRKMCQALN MLTVTGLDLL  240
GSDAFRGTTA ARQVQNSPVQ STASLESLDN RKSSEVTSCA ADMWP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1135142RRSRRRKQ
2137142SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965642.10.0PREDICTED: basic leucine zipper 9
TrEMBLK3XYN50.0K3XYN5_SETIT; Uncharacterized protein
STRINGSi007043m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20953796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.12e-30basic leucine zipper 9